A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10055
Swiss-prot Accession number	Q17192 (Sequence in FASTA format)
Description	Bombyxin A-1 precursor (BBX-A1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-1 B chain; Bombyxin A-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10271
References	1   Iwami M., Kawakami A., Ishizaki H., Takahashi S.Y., Adachi T.,Suzuki Y., Nagasawa H., Suzuki A.; "Cloning of a gene encoding bombyxin, an insulin-like brain secretorypeptide of the silkmoth Bombyx mori with prothoracicotropicactivity."; Dev. Growth Differ. 31:31-37(1989). 2  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-1 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10059
Swiss-prot Accession number	Q566B1 (Sequence in FASTA format)
Description	Bursicon precursor (Bursicon subunit alpha) (Cuticle-tanning hormone).
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Contains 1 CTCK (C-terminal cystine knot-like) domain.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading
Protein Length	160 Amino acids
Molecular weight	17901
References	1  PubMed abstract 15141943 2  PubMed abstract 15811337
Domain Name	N/A
Hormone Name	Bursicon
Mature Hormone Sequence	FPVTGHEVQLPPGTKFFCQECQMTAVIHVLKHRGCKPKAIPSFACIGKCTSYVQVSGSKIWQMERTCNCCQESGEREATVVLFCPDAQNEEKRFRKVSTKAPLQCMCRPCGSIEESSIIPQEVAGYSEEGPLYNHFRKSL
Position of mature hormone in Pre-Hormone protein	140 Residues from position (21-160)
Receptor	N/A
Gene ID	100049169
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10087
Swiss-prot Accession number	Q17192 (Sequence in FASTA format)
Description	Bombyxin A-1 precursor (BBX-A1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-1 B chain; Bombyxin A-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10271
References	1   Iwami M., Kawakami A., Ishizaki H., Takahashi S.Y., Adachi T.,Suzuki Y., Nagasawa H., Suzuki A.; "Cloning of a gene encoding bombyxin, an insulin-like brain secretorypeptide of the silkmoth Bombyx mori with prothoracicotropicactivity."; Dev. Growth Differ. 31:31-37(1989). 2  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-1 B chain
Mature Hormone Sequence	QQPQRVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10088
Swiss-prot Accession number	Q17194 (Sequence in FASTA format)
Description	Bombyxin B-10 precursor (BBX-B10) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-10 B chain; Bombyxin B-10 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	87 Amino acids
Molecular weight	9881
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-10 B chain
Mature Hormone Sequence	QEVAHTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	24 Residues from position (20-43)
Receptor	N/A
Gene ID	100169715
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10089
Swiss-prot Accession number	Q17194 (Sequence in FASTA format)
Description	Bombyxin B-10 precursor (BBX-B10) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-10 B chain; Bombyxin B-10 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	87 Amino acids
Molecular weight	9881
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-10 A chain
Mature Hormone Sequence	SVVDECCFRPCTLDVLLSYCD
Position of mature hormone in Pre-Hormone protein	21 Residues from position (67-87)
Receptor	N/A
Gene ID	100169715
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10090
Swiss-prot Accession number	Q17196 (Sequence in FASTA format)
Description	Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	93 Amino acids
Molecular weight	10744
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-11 B chain
Mature Hormone Sequence	QEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	24 Residues from position (23-46)
Receptor	N/A
Gene ID	100169656
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10093
Swiss-prot Accession number	P26736 (Sequence in FASTA format)
Description	Bombyxin D-1 precursor (BBX-D1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin D-1 B chain; Bombyxin D-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10106
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin D-1 A chain
Mature Hormone Sequence	GIADECCLQPCTNDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (71-90)
Receptor	N/A
Gene ID	100169725
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10421
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	Diapause hormone (DH) is responsible for induction of embryonic diapause
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Diapause hormone
Mature Hormone Sequence	TDMKDESDRGAHSERGALWFGPRL
Position of mature hormone in Pre-Hormone protein	24 Residues from position (24-47)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10422
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	The three SGNPS are far less active than DH in inducing diapause eggs. Beta-SGNP expressed higher pban activity than PBAN-I, but alpha- and gamma-SGNP were far less active in pheromonotropic activity
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Alpha-SG neuropeptide
Mature Hormone Sequence	IIFTPKL
Position of mature hormone in Pre-Hormone protein	7 Residues from position (97-103)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10423
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	The three SGNPS are far less active than DH in inducing diapause eggs. Beta-SGNP expressed higher pban activity than PBAN-I, but alpha- and gamma-SGNP were far less active in pheromonotropic activity
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Beta-SG neuropeptide
Mature Hormone Sequence	SVAKPQTHESLEFIPRL
Position of mature hormone in Pre-Hormone protein	17 Residues from position (106-122)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10424
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	PBAN is an hormone that controls sex pheromone production in female moths. PBAN also mediates visceral muscle contractile activity (myotropic activity). PBAN is identical to MRCH which is implicated in the formation of both melanin in the cuticle and ommochrome in the epidermis of armyworm species
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Pheromone biosynthesis-activating neuropeptide II
Mature Hormone Sequence	RLSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Position of mature hormone in Pre-Hormone protein	34 Residues from position (125-158)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10425
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	PBAN is an hormone that controls sex pheromone production in female moths. PBAN also mediates visceral muscle contractile activity (myotropic activity). PBAN is identical to MRCH which is implicated in the formation of both melanin in the cuticle and ommochrome in the epidermis of armyworm species
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Pheromone biosynthesis-activating neuropeptide I
Mature Hormone Sequence	LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL
Position of mature hormone in Pre-Hormone protein	33 Residues from position (126-158)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10426
Swiss-prot Accession number	P09971 (Sequence in FASTA format)
Description	PBAN-type neuropeptides precursor [Contains: Diapause hormone (DH);Alpha-SG neuropeptide (Alpha-SGNP); Beta-SG neuropeptide (Beta-SGNP);Pheromone biosynthesis-activating neuropeptide I (PBAN-I) (BoM-PBAN)(Melanization and reddish coloration hormone I) (MRCH-I); Pheromonebiosynthesis-activating neuropeptide II (PBAN-II); Gamma-SGneuropeptide (Gamma-SGNP)].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the pyrokinin family.
Tissue Specificity	Suboesophageal ganglion
Post translational modification	N/A
Function	The three SGNPS are far less active than DH in inducing diapause eggs. Beta-SGNP expressed higher pban activity than PBAN-I, but alpha- and gamma-SGNP were far less active in pheromonotropic activity
Protein Length	192 Amino acids
Molecular weight	22326
References	1  PubMed abstract 1280417 2  PubMed abstract 8475067 3  PubMed abstract 1368584 4  PubMed abstract 2775285 5  PubMed abstract 8512566 6  PubMed abstract 3896851
Domain Name	N/A
Hormone Name	Gamma-SG neuropeptide
Mature Hormone Sequence	TMSFSPRL
Position of mature hormone in Pre-Hormone protein	8 Residues from position (161-168)
Receptor	N/A
Gene ID	692749
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10440
Swiss-prot Accession number	P17219 (Sequence in FASTA format)
Description	Prothoracicotropic hormone precursor (PTTH) [Contains: P2K; P6K;Prothoracicotropic hormone].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain
Post translational modification	N/A
Function	Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions
Protein Length	224 Amino acids
Molecular weight	26028
References	1  PubMed abstract 2315701 2  PubMed abstract 8125124 3  PubMed abstract 1368675 4  PubMed abstract 8180220
Domain Name	N/A
Hormone Name	P2K
Mature Hormone Sequence	PDVGGFMVEDQRTHKSHNYMM
Position of mature hormone in Pre-Hormone protein	21 Residues from position (33-53)
Receptor	N/A
Gene ID	692767
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10441
Swiss-prot Accession number	P17219 (Sequence in FASTA format)
Description	Prothoracicotropic hormone precursor (PTTH) [Contains: P2K; P6K;Prothoracicotropic hormone].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain
Post translational modification	N/A
Function	Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions
Protein Length	224 Amino acids
Molecular weight	26028
References	1  PubMed abstract 2315701 2  PubMed abstract 8125124 3  PubMed abstract 1368675 4  PubMed abstract 8180220
Domain Name	N/A
Hormone Name	P6K
Mature Hormone Sequence	ARNDVLGDKENVRPNPYYTEPFDPDTSPEELSALIVDYANMIRNDVILLDNSVETRT
Position of mature hormone in Pre-Hormone protein	57 Residues from position (56-112)
Receptor	N/A
Gene ID	692767
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 16

HMRbase accession number	10442
Swiss-prot Accession number	P17219 (Sequence in FASTA format)
Description	Prothoracicotropic hormone precursor (PTTH) [Contains: P2K; P6K;Prothoracicotropic hormone].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	PTTH is synthesized by two dorsolateral neurosecretory cells of the Bombyx brain
Post translational modification	N/A
Function	PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development
Protein Length	224 Amino acids
Molecular weight	26028
References	1  PubMed abstract 2315701 2  PubMed abstract 8125124 3  PubMed abstract 1368675 4  PubMed abstract 8180220
Domain Name	N/A
Hormone Name	Prothoracicotropic hormone
Mature Hormone Sequence	GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN
Position of mature hormone in Pre-Hormone protein	109 Residues from position (116-224)
Receptor	N/A
Gene ID	692767
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	10451
Swiss-prot Accession number	P29519 (Sequence in FASTA format)
Description	Bombyxin B-12 precursor (BBX-B12) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-12 B chain; Bombyxin B-12 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10124
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-12 B chain
Mature Hormone Sequence	EEQEVARTYCGAHLANTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169722
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	10527
Swiss-prot Accession number	P15411 (Sequence in FASTA format)
Description	Bombyxin A-2 precursor (BBX-A2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-2 B chain; Bombyxin A-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9979
References	1  PubMed abstract 2708384 2  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-2 B chain
Mature Hormone Sequence	QQPQEVHTYCGRHLARTMADLCWEEGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	693012
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	10528
Swiss-prot Accession number	P15411 (Sequence in FASTA format)
Description	Bombyxin A-2 precursor (BBX-A2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-2 B chain; Bombyxin A-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9979
References	1  PubMed abstract 2708384 2  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-2 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (70-89)
Receptor	N/A
Gene ID	693012
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	10529
Swiss-prot Accession number	P26726 (Sequence in FASTA format)
Description	Bombyxin A-3 precursor (BBX-A3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-3 B chain; Bombyxin A-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10273
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-3 B chain
Mature Hormone Sequence	QQPQGVHTYCGRHLARTLANLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	10530
Swiss-prot Accession number	P26726 (Sequence in FASTA format)
Description	Bombyxin A-3 precursor (BBX-A3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-3 B chain; Bombyxin A-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10273
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin A-3 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	10531
Swiss-prot Accession number	P26727 (Sequence in FASTA format)
Description	Bombyxin A-4 precursor (BBX-A4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-4 B chain; Bombyxin A-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10172
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-4 B chain
Mature Hormone Sequence	QQPQGVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169657
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	10532
Swiss-prot Accession number	P26727 (Sequence in FASTA format)
Description	Bombyxin A-4 precursor (BBX-A4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-4 B chain; Bombyxin A-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10172
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-4 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169657
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	10533
Swiss-prot Accession number	P26728 (Sequence in FASTA format)
Description	Bombyxin A-5 precursor (BBX-A5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-5 B chain; Bombyxin A-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10299
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-5 B chain
Mature Hormone Sequence	QQPQTVHTYCGHHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169658
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	10534
Swiss-prot Accession number	P26728 (Sequence in FASTA format)
Description	Bombyxin A-5 precursor (BBX-A5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-5 B chain; Bombyxin A-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10299
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-5 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169658
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	10535
Swiss-prot Accession number	P26729 (Sequence in FASTA format)
Description	Bombyxin A-6 precursor (BBX-A6) (Bombyxin-II) (4K-prothoracicotropichormone) (4K-PTTH) [Contains: Bombyxin A-6 B chain; Bombyxin A-6 Achain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10186
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744 3  PubMed abstract 7473749
Domain Name	Insulin
Hormone Name	Bombyxin A-6 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 27

HMRbase accession number	10536
Swiss-prot Accession number	P26729 (Sequence in FASTA format)
Description	Bombyxin A-6 precursor (BBX-A6) (Bombyxin-II) (4K-prothoracicotropichormone) (4K-PTTH) [Contains: Bombyxin A-6 B chain; Bombyxin A-6 Achain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10186
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744 3  PubMed abstract 7473749
Domain Name	Insulin
Hormone Name	Bombyxin A-6 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	1BOM   1BON
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 28

HMRbase accession number	10537
Swiss-prot Accession number	P26730 (Sequence in FASTA format)
Description	Bombyxin A-7 precursor (BBX-A7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-7 B chain; Bombyxin A-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10286
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-7 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 29

HMRbase accession number	10538
Swiss-prot Accession number	P26730 (Sequence in FASTA format)
Description	Bombyxin A-7 precursor (BBX-A7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-7 B chain; Bombyxin A-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10286
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-7 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 30

HMRbase accession number	10539
Swiss-prot Accession number	P26731 (Sequence in FASTA format)
Description	Bombyxin A-8 precursor (BBX-A8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-8 B chain; Bombyxin A-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9951
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-8 B chain
Mature Hormone Sequence	QQPQEVHTYCGRHLARTMADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100169709
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 31

HMRbase accession number	10540
Swiss-prot Accession number	P26731 (Sequence in FASTA format)
Description	Bombyxin A-8 precursor (BBX-A8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-8 B chain; Bombyxin A-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9951
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin A-8 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	100169709
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 32

HMRbase accession number	10541
Swiss-prot Accession number	P26732 (Sequence in FASTA format)
Description	Bombyxin A-9 precursor (BBX-A9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-9 B chain; Bombyxin A-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10288
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-9 B chain
Mature Hormone Sequence	QQPQAVHTYCGRHLARTLADLCWEAGVD
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 33

HMRbase accession number	10542
Swiss-prot Accession number	P26732 (Sequence in FASTA format)
Description	Bombyxin A-9 precursor (BBX-A9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin A-9 B chain; Bombyxin A-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	92 Amino acids
Molecular weight	10288
References	1  PubMed abstract 8683595 2  PubMed abstract 16593744
Domain Name	Insulin
Hormone Name	Bombyxin A-9 A chain
Mature Hormone Sequence	GIVDECCLRPCSVDVLLSYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (73-92)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 34

HMRbase accession number	10543
Swiss-prot Accession number	Q17196 (Sequence in FASTA format)
Description	Bombyxin B-11 precursor (BBX-B11) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-11 B chain; Bombyxin B-11 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	93 Amino acids
Molecular weight	10744
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-11 A chain
Mature Hormone Sequence	GPGVVDECCFRPCKLEVLKSFFFFFCD
Position of mature hormone in Pre-Hormone protein	27 Residues from position (67-93)
Receptor	N/A
Gene ID	100169656
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 35

HMRbase accession number	10544
Swiss-prot Accession number	P29519 (Sequence in FASTA format)
Description	Bombyxin B-12 precursor (BBX-B12) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-12 B chain; Bombyxin B-12 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10124
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-12 A chain
Mature Hormone Sequence	GVVDECCFQPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169722
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 36

HMRbase accession number	10545
Swiss-prot Accession number	P26733 (Sequence in FASTA format)
Description	Bombyxin B-1 precursor (BBX-B1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-1 B chain; Bombyxin B-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9945
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-1 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (20-45)
Receptor	N/A
Gene ID	100169719
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 37

HMRbase accession number	10546
Swiss-prot Accession number	P26733 (Sequence in FASTA format)
Description	Bombyxin B-1 precursor (BBX-B1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-1 B chain; Bombyxin B-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	9945
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-1 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	100169719
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 38

HMRbase accession number	10547
Swiss-prot Accession number	P26734 (Sequence in FASTA format)
Description	Bombyxin B-2 precursor (BBX-B2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-2 B chain; Bombyxin B-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	10039
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-2 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (20-45)
Receptor	N/A
Gene ID	100169721
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 39

HMRbase accession number	10548
Swiss-prot Accession number	P26734 (Sequence in FASTA format)
Description	Bombyxin B-2 precursor (BBX-B2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-2 B chain; Bombyxin B-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	89 Amino acids
Molecular weight	10039
References	1  PubMed abstract 2674935
Domain Name	Insulin
Hormone Name	Bombyxin B-2 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (69-89)
Receptor	N/A
Gene ID	100169721
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 40

HMRbase accession number	10549
Swiss-prot Accession number	P26737 (Sequence in FASTA format)
Description	Bombyxin B-3 precursor (BBX-B3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-3 B chain; Bombyxin B-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10152
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-3 B chain
Mature Hormone Sequence	EEQEVARTYCGAHLANTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 41

HMRbase accession number	10550
Swiss-prot Accession number	P26737 (Sequence in FASTA format)
Description	Bombyxin B-3 precursor (BBX-B3) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-3 B chain; Bombyxin B-3 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10152
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-3 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 42

HMRbase accession number	10551
Swiss-prot Accession number	P26738 (Sequence in FASTA format)
Description	Bombyxin B-4 precursor (BBX-B4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-4 B chain; Bombyxin B-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10103
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-4 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169720
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 43

HMRbase accession number	10552
Swiss-prot Accession number	P26738 (Sequence in FASTA format)
Description	Bombyxin B-4 precursor (BBX-B4) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-4 B chain; Bombyxin B-4 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10103
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-4 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169720
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 44

HMRbase accession number	10553
Swiss-prot Accession number	P26739 (Sequence in FASTA format)
Description	Bombyxin B-5 precursor (BBX-B5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-5 B chain; Bombyxin B-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10212
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-5 B chain
Mature Hormone Sequence	EEQEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 45

HMRbase accession number	10554
Swiss-prot Accession number	P26739 (Sequence in FASTA format)
Description	Bombyxin B-5 precursor (BBX-B5) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-5 B chain; Bombyxin B-5 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10212
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-5 A chain
Mature Hormone Sequence	GPGVVDECCFRPCKLEVLKSYCGV
Position of mature hormone in Pre-Hormone protein	24 Residues from position (67-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 46

HMRbase accession number	10555
Swiss-prot Accession number	P26740 (Sequence in FASTA format)
Description	Bombyxin B-6 precursor (BBX-B6) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-6 B chain; Bombyxin B-6 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10112
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-6 B chain
Mature Hormone Sequence	EAQEVARTYCGRDLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	100169723
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 47

HMRbase accession number	10556
Swiss-prot Accession number	P26740 (Sequence in FASTA format)
Description	Bombyxin B-6 precursor (BBX-B6) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-6 B chain; Bombyxin B-6 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10112
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-6 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	100169723
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 48

HMRbase accession number	10557
Swiss-prot Accession number	P26741 (Sequence in FASTA format)
Description	Bombyxin B-7 precursor (BBX-B7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-7 B chain; Bombyxin B-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10028
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-7 B chain
Mature Hormone Sequence	EAQEVARTYCGRHLADTLADLCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 49

HMRbase accession number	10558
Swiss-prot Accession number	P26741 (Sequence in FASTA format)
Description	Bombyxin B-7 precursor (BBX-B7) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-7 B chain; Bombyxin B-7 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10028
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-7 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLLSYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (70-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 50

HMRbase accession number	10559
Swiss-prot Accession number	P26742 (Sequence in FASTA format)
Description	Bombyxin B-8 precursor (BBX-B8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-8 B chain; Bombyxin B-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	88 Amino acids
Molecular weight	9706
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-8 B chain
Mature Hormone Sequence	EAQEVARTYCGSHLADTLADLCFGVV
Position of mature hormone in Pre-Hormone protein	26 Residues from position (19-44)
Receptor	N/A
Gene ID	100169718
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 51

HMRbase accession number	10560
Swiss-prot Accession number	P26742 (Sequence in FASTA format)
Description	Bombyxin B-8 precursor (BBX-B8) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-8 B chain; Bombyxin B-8 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	88 Amino acids
Molecular weight	9706
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-8 A chain
Mature Hormone Sequence	GVVDECCFRPCTLDVLASYCG
Position of mature hormone in Pre-Hormone protein	21 Residues from position (68-88)
Receptor	N/A
Gene ID	100169718
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 52

HMRbase accession number	10561
Swiss-prot Accession number	P26743 (Sequence in FASTA format)
Description	Bombyxin B-9 precursor (BBX-B9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-9 B chain; Bombyxin B-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10284
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-9 B chain
Mature Hormone Sequence	EEQEVARTYCGRHLANILAYVCFGVE
Position of mature hormone in Pre-Hormone protein	26 Residues from position (21-46)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 53

HMRbase accession number	10562
Swiss-prot Accession number	P26743 (Sequence in FASTA format)
Description	Bombyxin B-9 precursor (BBX-B9) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin B-9 B chain; Bombyxin B-9 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10284
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin B-9 A chain
Mature Hormone Sequence	EPGVVDECCFRPCKLEVLKSYCGV
Position of mature hormone in Pre-Hormone protein	24 Residues from position (67-90)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 54

HMRbase accession number	10563
Swiss-prot Accession number	P15410 (Sequence in FASTA format)
Description	Bombyxin C-1 precursor (BBX-C1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-1 B chain; Bombyxin C-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	91 Amino acids
Molecular weight	10137
References	1   Iwami M., Adachi T., Kondo H., Kawakami A., Suzuki Y., Nagasawa H.,Suzuki A., Ishizaki H.; "A novel family C of the genes that encode bombyxin, an insulin-related brain secretory peptide of the silkmoth Bombyx mori: isolationand characterization of gene C-1."; Insect Biochem. 20:295-303(1990). 2  PubMed abstract 8683595 3  PubMed abstract 2708384
Domain Name	Insulin
Hormone Name	Bombyxin C-1 B chain
Mature Hormone Sequence	QTASQFYCGDFLARTMSSLCWSDMQ
Position of mature hormone in Pre-Hormone protein	25 Residues from position (20-44)
Receptor	N/A
Gene ID	100147698
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 55

HMRbase accession number	10564
Swiss-prot Accession number	P15410 (Sequence in FASTA format)
Description	Bombyxin C-1 precursor (BBX-C1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-1 B chain; Bombyxin C-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	91 Amino acids
Molecular weight	10137
References	1   Iwami M., Adachi T., Kondo H., Kawakami A., Suzuki Y., Nagasawa H.,Suzuki A., Ishizaki H.; "A novel family C of the genes that encode bombyxin, an insulin-related brain secretory peptide of the silkmoth Bombyx mori: isolationand characterization of gene C-1."; Insect Biochem. 20:295-303(1990). 2  PubMed abstract 8683595 3  PubMed abstract 2708384
Domain Name	Insulin
Hormone Name	Bombyxin C-1 A chain
Mature Hormone Sequence	GIVDECCYRPCTIDVLMSYCDN
Position of mature hormone in Pre-Hormone protein	22 Residues from position (70-91)
Receptor	N/A
Gene ID	100147698
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 56

HMRbase accession number	10565
Swiss-prot Accession number	P26735 (Sequence in FASTA format)
Description	Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	95 Amino acids
Molecular weight	10605
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin C-2 B chain
Mature Hormone Sequence	QTASQFYCGDFLARTMSILCWPDMP
Position of mature hormone in Pre-Hormone protein	25 Residues from position (20-44)
Receptor	N/A
Gene ID	100147697
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 57

HMRbase accession number	10566
Swiss-prot Accession number	P26735 (Sequence in FASTA format)
Description	Bombyxin C-2 precursor (BBX-C2) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin C-2 B chain; Bombyxin C-2 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	95 Amino acids
Molecular weight	10605
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin C-2 A chain
Mature Hormone Sequence	GIVDECCYRPCTTDVLKLYCDKQITI
Position of mature hormone in Pre-Hormone protein	26 Residues from position (70-95)
Receptor	N/A
Gene ID	100147697
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 58

HMRbase accession number	10567
Swiss-prot Accession number	P26736 (Sequence in FASTA format)
Description	Bombyxin D-1 precursor (BBX-D1) (4K-prothoracicotropic hormone) (4K-PTTH) [Contains: Bombyxin D-1 B chain; Bombyxin D-1 A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	90 Amino acids
Molecular weight	10106
References	1  PubMed abstract 8683595
Domain Name	Insulin
Hormone Name	Bombyxin D-1 B chain
Mature Hormone Sequence	ASEEGHIYCGRYLAYKMADLCWRAGFE
Position of mature hormone in Pre-Hormone protein	27 Residues from position (19-45)
Receptor	N/A
Gene ID	100169725
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 59

HMRbase accession number	10568
Swiss-prot Accession number	P21808 (Sequence in FASTA format)
Description	Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropichormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTTH is a brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	98 Amino acids
Molecular weight	10987
References	1  PubMed abstract 9253178 2   Maruyama K., Hietter H., Nagasawa H., Isogai A., Tamura S., Suzuki A.,Ishizaki H.; "Isolation and primary structure of bombyxin-IV, a novel molecularspecies of bombyxin from the silkworm, Bombyx mori."; Agric. Biol. Chem. 52:3035-3041(1988). 3  PubMed abstract 1515030
Domain Name	Insulin
Hormone Name	Bombyxin E-1 B chain
Mature Hormone Sequence	QEANVAHHYCGRHLANTLADLCWDTSVE
Position of mature hormone in Pre-Hormone protein	28 Residues from position (20-47)
Receptor	N/A
Gene ID	100146109
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 60

HMRbase accession number	10569
Swiss-prot Accession number	P21808 (Sequence in FASTA format)
Description	Bombyxin E-1 precursor (BBX-E1) (Bombyxin IV) (4K-prothoracicotropichormone IV) (4K-PTTH-IV) [Contains: Bombyxin E-1 B chain; Bombyxin E-1A chain].
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTTH is a brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects
Protein Length	98 Amino acids
Molecular weight	10987
References	1  PubMed abstract 9253178 2   Maruyama K., Hietter H., Nagasawa H., Isogai A., Tamura S., Suzuki A.,Ishizaki H.; "Isolation and primary structure of bombyxin-IV, a novel molecularspecies of bombyxin from the silkworm, Bombyx mori."; Agric. Biol. Chem. 52:3035-3041(1988). 3  PubMed abstract 1515030
Domain Name	Insulin
Hormone Name	Bombyxin E-1 A chain
Mature Hormone Sequence	GVVDECCIQPCTLDVLATYC
Position of mature hormone in Pre-Hormone protein	20 Residues from position (79-98)
Receptor	N/A
Gene ID	100146109
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 61

HMRbase accession number	10602
Swiss-prot Accession number	P25331 (Sequence in FASTA format)
Description	Eclosion hormone precursor (Ecdysis activator) (EH).
Source organism	Bombyx mori (Silk moth)
Taxonomical Classification	Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Bombycoidea;Bombycidae; Bombyx.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the insect eclosion hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns: larval, pupal and adult ecdysis, and plasticization during the molt
Protein Length	88 Amino acids
Molecular weight	9505
References	1  PubMed abstract 1370883 2   Kono T., Nagasawa H., Isogai A., Fugo H., Suzuki A.; "Amino acid sequence of eclosion hormone of the silkworm, Bombyxmori."; Agric. Biol. Chem. 51:2307-2308(1987).
Domain Name	Eclosion
Hormone Name	Eclosion hormone
Mature Hormone Sequence	SPAIASSYDAMEICIENCAQCKKMFGPWFEGSLCAESCIKARGKDIPECESFASISPFLNKL
Position of mature hormone in Pre-Hormone protein	62 Residues from position (27-88)
Receptor	N/A
Gene ID	692740
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated